PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo15G0042200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 169aa    MW: 19703.2 Da    PI: 11.0109
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo15G0042200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-18449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l+++v+++G+++W++Ia++++ gR++k+c++rw++ 
  Spipo15G0042200  4 RGHWRPSEDEKLKELVERYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding56.65.8e-185699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r ++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Spipo15G0042200 56 RSPFTPEEEERLLASHRIHGNR-WAVIARLFP-GRTDNAIKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.593154IPR017930Myb domain
SMARTSM007171.4E-15352IPR001005SANT/Myb domain
SuperFamilySSF466892.47E-30497IPR009057Homeodomain-like
PfamPF002493.1E-18449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-28557IPR009057Homeodomain-like
CDDcd001675.92E-14748No hitNo description
SMARTSM007172.9E-1555103IPR001005SANT/Myb domain
PROSITE profilePS5129420.5555105IPR017930Myb domain
PfamPF002497.9E-155698IPR001005SANT/Myb domain
CDDcd001671.28E-115898No hitNo description
Gene3DG3DSA:1.10.10.607.9E-2258104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MCTRGHWRPS EDEKLKELVE RYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRSPFT  60
PEEEERLLAS HRIHGNRWAV IARLFPGRTD NAIKNHWHVI MARRCREQSR LLAGKPTHGP  120
SKSQSLSKGT EKRVQENTSH ENLGPYSHLR ILTDLHSDFH RQPPRASPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-3321055108B-MYB
1mse_C2e-3311051105C-Myb DNA-Binding Domain
1msf_C2e-3311051105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012065267.19e-79PREDICTED: transcriptional activator Myb-like
SwissprotQ9FDW11e-38MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A097HUI31e-78A0A097HUI3_JATCU; MYB family protein
STRINGPOPTR_0015s05130.17e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.14e-72myb domain protein 52